Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Polypeptide fragment C and application thereof

A technology of polypeptide fragments and amino acids, applied in the field of biomedicine, can solve problems such as easy to produce immunogenicity, difficult to make drugs, reduce disease activity index and colon histopathological score in IBD mice

Active Publication Date: 2021-05-18
SHANGHAI LONGXIN BIOMEDICAL TECH CO LTD
View PDF6 Cites 2 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004] In order to solve the shortcomings of MIMP, which has an improving effect on inflammatory bowel disease in the prior art, which is prone to immunogenicity and difficult to be drugged, the purpose of the present invention is to provide an application of polypeptide fragment C, which can Significantly improved the pathological morphology of colon in IBD mice, decreased the disease activity index and colon histopathological score in IBD mice

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Polypeptide fragment C and application thereof
  • Polypeptide fragment C and application thereof
  • Polypeptide fragment C and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0030] Example 1: Experiment of the effect of MP-C intervention on DSS-induced inflammatory bowel disease in mice

[0031] The sequence of the polypeptide fragment C (MP-C) used in this example is that the 9th amino acid Xaa of the amino acid sequence shown in SEQ ID No. 1 is Val, the 20th amino acid Xaa is Tyr, and the 30th amino acid Xaa is Ser. The sequence when the 42nd amino acid Xaa is Arg, namely THTVGSYFVVQNGYVGAFSYALGNSEYAMSSPLGSLDGRTTRYNLL.

[0032] 1. Experimental method

[0033] 1.1 Establishment of mouse model of acute inflammatory bowel disease

[0034] When a certain concentration of DSS solution is administered to mice, an acute inflammatory bowel disease model characterized by diarrhea, blood in the stool, ulcers, and granulocyte infiltration can be induced. The experimental grouping followed the principle of randomness, and stratified random grouping was carried out according to the weight of the mice. Divide 40 healthy male C57BL6 mice into four groups of...

Embodiment 2

[0066] The reagents, materials, equipment, and experimental methods used in this example are the same as in Example 1, the only difference being that the sequence of the polypeptide fragment C (MP-C) used in this example is the amino acid shown in SEQ ID No.1 The 9th amino acid Xaa of the sequence is Tyr, the 20th amino acid Xaa is Ser, the 30th amino acid Xaa is Thr, and the 42nd amino acid Xaa is Gly, that is THTVGSYFYVQNGYVGAFSSALGNSEYAMTSPLGSLDGRTTGYNLL.

Embodiment 3

[0068] The reagents, materials, equipment, and experimental methods used in this example are the same as in Example 1, the only difference being that the sequence of the polypeptide fragment C (MP-C) used in this example is the amino acid shown in SEQ ID No.1 The 9th amino acid Xaa of the sequence is Gln, the 20th amino acid Xaa is Glu, the 30th amino acid Xaa is Pro, and the 42nd amino acid Xaa is Met, that is THTVGSYFQVQNGYVGAFSEALGNSEYAMPSPLGSLDGRTTMYNLL.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to the technical field of biological medicines, and particularly relates to a polypeptide fragment C and application thereof. The polypeptide fragment C comprises an amino acid sequence as shown in SEQ ID No.1. The ninth amino acid Xaa is Tyr, Val, Gly, Ser or Gln, the 20th amino acid Xaa is Ser, Gln, Glu or Tyr, the 30th amino acid Xaa is Asn, Thr, Ser, Pro or Leu, and the 42nd amino acid Xaa is Gly, Arg, Met or does not exist. The MP-C obviously improves the colon pathological form of an IBD mouse model, reduces the disease activity index and the colon histopathologic score, and has the capability of intervening the occurrence of mouse inflammatory bowel diseases.

Description

technical field [0001] The invention belongs to the technical field of biomedicine, and in particular relates to a polypeptide fragment C and its application. Background technique [0002] Inflammatory bowel disease (IBD) is an idiopathic chronic intestinal inflammatory disease. Its lesions are mainly located in the colorectal segment and involve the mucosa and muscularis mucosa. In severe cases, there are liver and gallbladder, muscle skin and blood coagulation. In terms of complications, 20-30% of patients with recurrent disease may transform into colorectal cancer, which is a very serious intestinal inflammatory disease and can be divided into ulcerative colitis (ulcerative colitis, UC) and Crohn's disease (Crohn's disease, CD) two categories. At present, IBD is considered to be an intestinal inflammatory reaction caused by the abnormality of intestinal mucosal innate immunity and acquired immunity under the interaction of multiple factors such as environment, genetics, ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/335A61K38/16A61P1/00A23L33/18
CPCC07K14/335A61P1/00A23L33/18A61K38/00A23V2002/00A23V2200/32C12R2001/25C07K14/001
Inventor 张彩华常英
Owner SHANGHAI LONGXIN BIOMEDICAL TECH CO LTD
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com