Eucheuma muricatum extract and application of Eucheuma muricatum extract in preparation of drugs for treatment of organ fibrosis
A technology of organ fibrosis and Eucheuma, applied in drug combination, drug delivery, pharmaceutical formula, etc., can solve the problems of unreported and undiscovered Eucheuma polypeptide components, and achieve a significant effect on the treatment of organ fibrosis
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0031] A kind of Eucheuma extract, its preparation method comprises the following steps:
[0032] 1) Wash Eucheuma;
[0033] 2) Take 100g of the Eucheuma treated in step 1), add 1000g of water, go through homogenization, high-pressure steam sterilization, three-layer gauze filtration, centrifugation in sequence, collect the supernatant, and ultrafiltration with an ultrafiltration membrane system, 0.1 A microporous membrane with a molecular weight cut-off of 5000 Daltons and an operating pressure difference of 0.1-0.5 MPa to obtain Eucheuma extract (containing 1% tripeptide molecules: GIYYGQCSEICGINHGFMPIVVEATSLPNYVSWISNKLNE, MISDSQIFIAMLFALVSAVLAIQLGAELYS, TGACFCLIYQGVLYP); wherein, the centrifugal speed is 3500 rpm per minute, the centrifugation time is 10 minutes. High pressure steam sterilization control parameters are as follows: 0.6 kg / cm 2 Sterilize under pressure (110°C) for 10 minutes; the gauze is medical gauze with 2mmX1mm holes.
Embodiment 2
[0035] A kind of Eucheuma extract, its preparation method comprises the following steps:
[0036] 1) Wash Eucheuma;
[0037] 2) Take 100g of the Eucheuma treated in step 1), add 800g of water, go through homogenization, high-pressure steam sterilization, three-layer gauze filtration, centrifugation in sequence, collect the supernatant, and use an ultrafiltration membrane system for ultrafiltration, 0.1 micron microporous membrane, the molecular weight cut-off is 5000 Daltons, and the operating pressure difference is 0.1-0.5MPa to obtain the Eucheuma extract (containing 1% tripeptide molecules: GIYYGQCSEICGINHGFMPIVVEATSLPNYVSWISNKLNE, MISDSQIFIAMLFALVSAVLAIQLGAELYS, TGACFCLIYQGVLYP); wherein, the centrifugal speed is 3000 rpm per minute, the centrifugation time is 8 minutes. Others are the same as in Example 1.
Embodiment 3
[0039] A kind of Eucheuma extract, its preparation method comprises the following steps:
[0040] 1) Wash Eucheuma;
[0041] 2) Take 100g of the Eucheuma treated in step 1), add 1200g of water, go through homogenization, high-pressure steam sterilization, three-layer gauze filtration, centrifugation in sequence, collect the supernatant, and use an ultrafiltration membrane system for ultrafiltration, 0.1 micron microporous membrane, the molecular weight cut-off is 5000 Daltons, and the operating pressure difference is 0.1-0.5MPa to obtain the Eucheuma extract (containing 1% tripeptide molecules: GIYYGQCSEICGINHGFMPIVVEATSLPNYVSWISNKLNE, MISDSQIFIAMLFALVSAVLAIQLGAELYS, TGACFCLIYQGVLYP); wherein, the centrifugal speed is 4000 rpm per minute, the centrifugation time is 12 minutes. Others are the same as in Example 1.
PUM

Abstract
Description
Claims
Application Information

- Generate Ideas
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com