Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

A kind of Eucheuma extract and its application in preparation of medicine for treating organ fibrosis

A technology of organ fibrosis and kylin cabbage, which is applied in the directions of drug combination, drug delivery, pharmaceutical formulation, etc., can solve the problems of unreported peptide components of kylin cabbage, no discovery in literature, etc., and achieve the effect of significantly treating organ fibrosis.

Active Publication Date: 2021-11-09
GUANGDONG ZHANJIANG PROVINCIAL LAB OF SOUTHERN MARINE SCI & ENG +1
View PDF4 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

In the prior art, there is no document reporting the function of Eucheuma polypeptide components in treating organ fibrosis, and there are no reports of using Eucheuma polypeptide components as drugs for treating organ fibrosis or food for special medical treatment at home and abroad.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • A kind of Eucheuma extract and its application in preparation of medicine for treating organ fibrosis
  • A kind of Eucheuma extract and its application in preparation of medicine for treating organ fibrosis
  • A kind of Eucheuma extract and its application in preparation of medicine for treating organ fibrosis

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0031] A kind of Eucheuma extract, its preparation method comprises the following steps:

[0032] 1) Wash Eucheuma;

[0033] 2) Take 100g of the Eucheuma treated in step 1), add 1000g of water, go through homogenization, high-pressure steam sterilization, three-layer gauze filtration, centrifugation in sequence, collect the supernatant, and ultrafiltration with an ultrafiltration membrane system, 0.1 A microporous membrane with a molecular weight cut-off of 5000 Daltons and an operating pressure difference of 0.1-0.5 MPa to obtain Eucheuma extract (containing 1% tripeptide molecules: GIYYGQCSEICGINHGFMPIVVEATSLPNYVSWISNKLNE, MISDSQIFIAMLFALVSAVLAIQLGAELYS, TGACFCLIYQGVLYP); wherein, the centrifugal speed is 3500 rpm per minute, the centrifugation time is 10 minutes. High pressure steam sterilization control parameters are as follows: 0.6 kg / cm 2 Sterilize under pressure (110°C) for 10 minutes; the gauze is medical gauze with 2mmX1mm holes.

Embodiment 2

[0035] A kind of Eucheuma extract, its preparation method comprises the following steps:

[0036] 1) Wash Eucheuma;

[0037] 2) Take 100g of the Eucheuma treated in step 1), add 800g of water, go through homogenization, high-pressure steam sterilization, three-layer gauze filtration, centrifugation in sequence, collect the supernatant, and use an ultrafiltration membrane system for ultrafiltration, 0.1 micron microporous membrane, the molecular weight cut-off is 5000 Daltons, and the operating pressure difference is 0.1-0.5MPa to obtain the Eucheuma extract (containing 1% tripeptide molecules: GIYYGQCSEICGINHGFMPIVVEATSLPNYVSWISNKLNE, MISDSQIFIAMLFALVSAVLAIQLGAELYS, TGACFCLIYQGVLYP); wherein, the centrifugal speed is 3000 rpm per minute, the centrifugation time is 8 minutes. Others are the same as in Example 1.

Embodiment 3

[0039] A kind of Eucheuma extract, its preparation method comprises the following steps:

[0040] 1) Wash Eucheuma;

[0041] 2) Take 100g of the Eucheuma treated in step 1), add 1200g of water, go through homogenization, high-pressure steam sterilization, three-layer gauze filtration, centrifugation in sequence, collect the supernatant, and use an ultrafiltration membrane system for ultrafiltration, 0.1 micron microporous membrane, the molecular weight cut-off is 5000 Daltons, and the operating pressure difference is 0.1-0.5MPa to obtain the Eucheuma extract (containing 1% tripeptide molecules: GIYYGQCSEICGINHGFMPIVVEATSLPNYVSWISNKLNE, MISDSQIFIAMLFALVSAVLAIQLGAELYS, TGACFCLIYQGVLYP); wherein, the centrifugal speed is 4000 rpm per minute, the centrifugation time is 12 minutes. Others are the same as in Example 1.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention discloses an oral liquid for preventing and treating organ fibrosis prepared by Eucheuma extract. Solvent 0.1%‑1%, the balance of Eucheuma extract. The preparation method of the Eucheuma extract comprises the following steps: 1) washing the Eucheuma extract; 2) taking the Eucheuma treated in step 1) whose quality is M1, adding water whose quality is M2, and successively homogenizing, sterilizing, Filtration, centrifugation, collecting the supernatant, and then ultrafiltration with an ultrafiltration membrane system, a microporous membrane of 0.1 microns, a molecular weight cut-off of 5000 Daltons, and an operating pressure difference of 0.1‑0.5MPa to obtain Eucheuma extract, wherein, M1:M2=1:8-12. The oral liquid prepared by the invention has remarkable efficacy in treating organ fibrosis, and is better than pirfenidone and nibnida in treating organ fibrosis. In addition, the preparation method of Eucheuma extract adopts ultrafiltration membrane system pressurized ultrafiltration, and the efficiency is better than that of chromatography extraction technology.

Description

technical field [0001] The invention relates to the technical field of food and medicine, and more specifically relates to an Eucheuma extract and its application in the preparation of medicines for treating organ fibrosis. Background technique [0002] Fibrosis can occur in a variety of organs. The main pathological changes are the increase of fibrous connective tissue and the reduction of parenchymal cells in organ tissues. Continuous progress can lead to organ structural damage, functional decline, and even failure, which seriously threaten human health and life. Worldwide, tissue fibrosis is the main cause of disability and death in many diseases. According to relevant statistics in the United States, nearly 45% of patients who died of various diseases can be attributed to tissue fibroproliferative diseases. At present, in the pharmaceutical industry, the types of drugs used to treat organ fibrosis are very scarce. The currently marketed drug pirfenidone can only relieve...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): A61K38/02A61K36/04A61K9/08A61P43/00
CPCA61K9/0095A61K36/04A61K47/14A61K2236/53A61P43/00
Inventor 张海涛余华军伍俊罗辉
Owner GUANGDONG ZHANJIANG PROVINCIAL LAB OF SOUTHERN MARINE SCI & ENG
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com