Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Genetic variants associated with lithium response in bipolar disorder

A bipolar, emotional technology, applied in the direction of biochemical equipment and methods, microbiological determination/inspection, inorganic active ingredients, etc., can solve problems such as no curative effect

Inactive Publication Date: 2016-03-02
ACAD SINIC
View PDF2 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, there are many patients who do not respond to lithium therapy

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Genetic variants associated with lithium response in bipolar disorder
  • Genetic variants associated with lithium response in bipolar disorder
  • Genetic variants associated with lithium response in bipolar disorder

Examples

Experimental program
Comparison scheme
Effect test

Embodiment Construction

[0009] The discovery of a correlation between genetic variants of glutamate decarboxylase-like 1 (GADL1) and lithium efficacy in patients with bipolar disorder was unexpected. Patients with one or more variants of the GADL1 gene were more likely to respond to lithium therapy.

[0010] GADL1 belongs to the second group of decarboxylase (decarboxylase) family, such as the position of the genome (chromosome No. 3), genomic DNA sequence (see, for example, NC_000003.11ReferenceGRCh37.p13PrimaryAssembly, chr3:30767692-30936153), cDNA sequence (see AccessionNo.NM_207359.2) and human GADL1 protein sequence (see eg AccessionNo.NP_997242.2).

[0011] The amino acid sequence of an exemplary GADL1 polypeptide and the cDNA sequence encoding the polypeptide are shown below.

[0012] Human GADL1 amino acid sequence (SEQ ID NO: 1):

[0013] MSSDSDRQCPVDGDIDQQEMIPSKKNAVLVDGVVLNGPTTDAKAGEKFVEEACRLIMEEVVLKATDVNEKVCEWRPPEQLKQLLDLEMRDSGEPPHKLLELCRDVIHYSVKTNHPRFFNQLYAGLDYYSLVARFMTEALNPSVYTYEVSPVF...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

Described herein is a method of determining lithium responsiveness in a bipolar disorder patient. The method includes obtaining a sample from a patient having bipolar disorder, and assaying the sample for the presence or absence of one or more glutamate decarboxylase-like 1 (GADL1) gene variants selected from the group consisting of a T allele of the single nucleotide polymorphism (SNP) rs17026688, a G allele of the SNP rs17026651, and GADL1 1VS8+48delG. The presence of one or more of the GADL1 gene variants indicates that the patient is responsive to lithium treatment.

Description

technical field [0001] The present invention relates to a kind of personalized medicine treatment utilizing single nucleotide polymorphism (Single Nucleotide Polymorphism, SNP). Background technique [0002] Bipolar disorder (Biopolardisorder) is characterized by the recurrent abnormal emotional state of two extremes of agitation and depression, see, for example: Müller-Oerlinghausen et al., Lancet2002; 359:241-7; and FryeMA., NEnglJMed2011; 364:51 -9. Recently, lithium salt (lithium) is the first-line drug for long-term treatment of bipolar disorder, which can effectively reduce the risk of relapse and suicide in patients, see eg: Fountoulakis et al., EurArchPsychiatryClinNeurosci2012;262Suppl1:1-48. However, there are many patients who do not respond to lithium therapy. Contents of the invention [0003] The invention provides a method for detecting the curative effect of lithium salts (lithium) on patients with bipolar disorder, the method comprising: obtaining a samp...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C12Q1/68C12N15/11
CPCC12Q1/6883C12Q2600/106C12Q2600/156C12Q2600/172A61K33/00
Inventor 陈垣崇郑泰安陈建勋李朝雄李明达
Owner ACAD SINIC
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Patsnap Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Patsnap Eureka Blog
Learn More
PatSnap group products

Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.

© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com