Novel therapeutics for brain cancer
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Benefits of technology
Problems solved by technology
Method used
Image
Examples
example 1
A. Example 1
[0397]In some embodiments, the compounds (e.g., compounds of formula (I), (II), (III), (IV), (V), (VI), (VII), (VIII), or (IX)) described herein interfere with Olig2 dimerization with itself and partner proteins by blocking binding hotspots within the dimerization region. The pharmacophore for this region is defined herein (FIG. 1). The pharmacophore shown in FIG. 1 was used in generating an in silico compound search of small molecules described herein (e.g., in Table 1 or 2). The inhibitors in Table 3 were screen in a cell-based glioblastoma assay. These molecules were used in the design of additional inhibitors (Tables 1 and 2).
[0398]Table 3 feft column in table is compound number, second column is chemical registry number, middle column shows the structure, and the last column indicates the IC50 in micromoles (μM) for human glioblastoma cells in culture.
example 2
B. Example 2
[0399]From the dimerization region of Olig2 specific peptide sequences have been identified, which are shown in Table 4. These sequences are important in generating peptide probes for testing dimerization inhibition and are the basis of making peptidomimetic molecules. The sequence of the OLIG2 molecule directly involved in dimerization has been identified:
RLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSL
[0400]Table 4 lists peptide sequences predicted to bind the brown and gray colored regions which are most important for dimerization. Some sequences overlap both the loop and the direct contact sites which may increase target affinity. Sequence number 12 is a probe for the loop region, as this may block dimerization. The peptide RNYILMLTN has been synthesized.
[0401]Applicants have performed homology modeling of E47 and OLIG2 based on the crystal structure of E47 and the amino acid sequence of both proteins, and have identified the dimerization region of OLIG2.
[04...
example 3
C. Example 3
[0406]Applicants have optimized the design of several novel druggable Olig2 inhibitors. These new compounds are shown in Table 1 and 2 below. Tables 1 and 2 show analogues of Olig2 inhibitors from a pharmacophore similarity search with improved druggability profiles.
PUM
Property | Measurement | Unit |
---|---|---|
Structure | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com