A kind of method for producing all male Macrobrachium rosenbergii seeds
A technology of Macrobrachium rosenbergii and shrimp seedlings, applied in the field of genetic engineering, can solve the problems of low reversal efficiency, limited promotion, low efficiency of false female shrimp, etc., and achieve the effect of improving success rate and reducing infection mortality
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment Construction
[0039] The present invention will be specifically introduced below in conjunction with the accompanying drawings and specific embodiments.
[0040] Macrobrachium rosenbergii sex regulation gene: Macrobrachium rosenbergii DMRT1 mRNA
[0041] Amino acid sequence:
[0042] "MECGGYESEGKGKRKQHCTYCKNHGKKSRKTNHKCEHEECECLLCKLTRLSRLIMRHQQRLWRHLKDSKRRQNAAADAGGTAAGSGACEPSGEHTDSSGAAQGASSTKLQKCDMCRNHGEIMSKRAHKNACPYQDCPCELCSLTRKRRYIMXLQQRVRRSQVXSKQHNEVWEYVTQATAELEFLGLQDIHQTTEDHNASSSLSESSSSPSPDSSSTSGSLPHKPEVIXPNPVTPTXPAXTNRTRSKDTESSPVPMDMPPLEPLPECSPTRYSPRPPAPPFNVPSPAATSRIRTSYPSPPPPNPLPPNRGLTNVPPMEIEPAWMNLKREREEVLKMNPKVQTREENLFGHLDFMKDQLTMTGRLEPPVPPEGSRSFHNTAVAMNFGSSHVPPYKSLVPMIDTNHLPPPPLQKSRADCNLHFQYRSMVWGNVPTEPSVGFVPDDFQQQCYRSLLVNNADVRVQPPPGLIQIPRPQHPLRPRPLAPVRPHVLPVNVECDHVNLHYLAYFLQNQREHYRDTLSTLSTTRSFGLPREALFLHHPVP"
[0043] Nucleotide sequence:
[0044]cactgctacactgcgtctgcgcaaacgacctcgagatggagtgcgggggctacgagagcgagggcaagggcaagaggaagcagcactgcacctactgcaagaaccacgggaagaagagtcgcaagaccaaccacaag...
PUM
Abstract
Description
Claims
Application Information
- R&D Engineer
- R&D Manager
- IP Professional
- Industry Leading Data Capabilities
- Powerful AI technology
- Patent DNA Extraction
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2024 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com