Supercharge Your Innovation With Domain-Expert AI Agents!

Nucleic acids and proteins from streptococcus groups A & B

a technology of streptococcus and nucleic acids, applied in the field of nucleic acids and proteins, can solve problems such as infection

Inactive Publication Date: 2006-09-21
NOVARTIS VACCINES & DIAGNOSTICS INC
View PDF95 Cites 48 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

When host defences are compromised, or when the organism is able to exert its virulence, or when it is introduced to vulnerable tissues or hosts, however, an acute infection occurs.

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Nucleic acids and proteins from streptococcus groups A & B

Examples

Experimental program
Comparison scheme
Effect test

example 1

[0384] A DNA sequence (GASx127) was identified in S.pyogenes which encodes the amino acid sequence . Analysis of this protein sequence reveals the following:

Possible site: 17>>> Seems to have a cleavable N-term signal seq.   INTEGRAL Likelihood = −3.93Transmembrane 312-328 (311-337)----- Final Results -----bacterial membrane --- Certainty = 0.2572(Affirmative) bacterial outside --- Certainty = 0.0000(Not Clear) bacterial cytoplasm --- Certainty = 0.0000(Not Clear)

No corresponding DNA sequence was identified in S.agalactiae.

[0385] The protein has homology with the following sequences in the GENPEPT database:

>GP:AAC97152 GB:U49397 unknown [Streptococcus pyogenes]Identities = 125 / 355 (35%), Positives = 191 / 355 (53%),Gaps = 26 / 355 (7%)Query:1MKLRHLLLTGAALTSFA-----ATTVHGET--VVNGAKLTVTKNL-DLVNSNALIPNTDF52MK   LLL  A L +       +  +  ET  V++G+ L V K      + N L+P  D+Sbjct:1MKKNKLLLATAILATALGMASMSQNIKAETAGVIDGSTLVVKKTFPSYTDDNVLMPKADY60Query:53TFKIEPDTTVN---EDGNKFK-GVALNTPMTK-VTYTNSDKGG...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

PropertyMeasurementUnit
MWaaaaaaaaaa
MWaaaaaaaaaa
concentrationaaaaaaaaaa
Login to View More

Abstract

The invention provides proteins from group B streptococcus (Streptococcus agalactiae) and group A streptococcus (Streptococcus pyogenes), including amino acid sequences and the corresponding nucleotide sequences. Data are given to show that the proteins are useful antigens for vaccines, immunogenic compositions, and / or diagnostics. The proteins are also targets for antibiotics.

Description

[0001] This application is a continuation of Ser. No. 10 / 415,182 filed Apr. 28, 2003. Ser. No. 10 / 415,182 is a National Stage application of PCT application PCT / GB01 / 04789, which was filed Oct. 29, 2001 and published in English under PCT Article 21(2) on May 2, 2002. PCT / GB01 / 04789 claims the benefit of Ser. No. GB0026333.5 filed Oct. 27, 2000, Ser. No. GB0028727.6 filed Nov. 24, 2000, and Ser. No. GB0105640.7 filed Mar. 7, 2001. Each of these applications and all the other documents cited herein are incorporated by reference in their entireties. [0002] This application incorporates by reference the contents of each of two duplicate CD-ROMS which contain an identical 21.0 MB file labeled “PP016620.0025 sequence listing.txt,” which is the sequence listing for this application. The CD-ROMs were created on Mar. 20, 2006.TECHNICAL FIELD [0003] This invention relates to nucleic acid and proteins from the bacteria Streptococcus agalactiae (GBS) and Streptococcus pyogenes (GAS). BACKGROUND...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(United States)
IPC IPC(8): C12Q1/68C07H21/04C12P21/06A61K39/02A61K39/295A61K39/116C12N1/21C07K14/315C12N15/74A61K39/00
CPCA61K38/00A61K39/00A61K2039/505A61K2039/53C07K2319/00C07K14/315C12N9/1088C12Y205/01018A61P1/02A61P15/00A61P21/00A61P27/16A61P29/02A61P31/04A61P31/10A61P31/12A61P31/14A61P33/02A61P37/04A61P43/00Y02A50/30A61K39/092C07K16/1275C07K16/40
Inventor TELFORD, JOHNMASIGNANI, VEGAROS, IMMACULADAGRANDI, GUIDOFRASER, CLAIRETETTELIN, HERVE
Owner NOVARTIS VACCINES & DIAGNOSTICS INC
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More