Nucleic acids and proteins from streptococcus groups A & B
a technology of streptococcus and nucleic acids, applied in the field of nucleic acids and proteins, can solve problems such as infection
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
example 1
[0384] A DNA sequence (GASx127) was identified in S.pyogenes which encodes the amino acid sequence . Analysis of this protein sequence reveals the following:
Possible site: 17>>> Seems to have a cleavable N-term signal seq. INTEGRAL Likelihood = −3.93Transmembrane 312-328 (311-337)----- Final Results -----bacterial membrane --- Certainty = 0.2572(Affirmative) bacterial outside --- Certainty = 0.0000(Not Clear) bacterial cytoplasm --- Certainty = 0.0000(Not Clear)
No corresponding DNA sequence was identified in S.agalactiae.
[0385] The protein has homology with the following sequences in the GENPEPT database:
>GP:AAC97152 GB:U49397 unknown [Streptococcus pyogenes]Identities = 125 / 355 (35%), Positives = 191 / 355 (53%),Gaps = 26 / 355 (7%)Query:1MKLRHLLLTGAALTSFA-----ATTVHGET--VVNGAKLTVTKNL-DLVNSNALIPNTDF52MK LLL A L + + + ET V++G+ L V K + N L+P D+Sbjct:1MKKNKLLLATAILATALGMASMSQNIKAETAGVIDGSTLVVKKTFPSYTDDNVLMPKADY60Query:53TFKIEPDTTVN---EDGNKFK-GVALNTPMTK-VTYTNSDKGG...
PUM
Property | Measurement | Unit |
---|---|---|
MW | aaaaa | aaaaa |
MW | aaaaa | aaaaa |
concentration | aaaaa | aaaaa |
Abstract
Description
Claims
Application Information

- R&D
- Intellectual Property
- Life Sciences
- Materials
- Tech Scout
- Unparalleled Data Quality
- Higher Quality Content
- 60% Fewer Hallucinations
Browse by: Latest US Patents, China's latest patents, Technical Efficacy Thesaurus, Application Domain, Technology Topic, Popular Technical Reports.
© 2025 PatSnap. All rights reserved.Legal|Privacy policy|Modern Slavery Act Transparency Statement|Sitemap|About US| Contact US: help@patsnap.com