Looking for breakthrough ideas for innovation challenges? Try Patsnap Eureka!

Tobacco transcription repressor protein ofp1 and its application

A technology for suppressing proteins and tobacco, which is applied in the field of tobacco genetic engineering and can solve the problems of producing harmful substances, affecting the grade and quality of tobacco, and poor appearance and quality.

Active Publication Date: 2022-06-03
ZHENGZHOU TOBACCO RES INST OF CNTC
View PDF1 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

"Green-yellow smoke" not only has poor appearance, but also produces harmful substances when burned, which in turn affects the grade and quality of tobacco

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Tobacco transcription repressor protein ofp1 and its application
  • Tobacco transcription repressor protein ofp1 and its application
  • Tobacco transcription repressor protein ofp1 and its application

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0037] The PCR amplification program is: 95°C pre-denaturation for 3 min; 95°C denaturation for 15s, 55°C annealing for 15s, 72°C extension for 30s, 34°C

[0038] The PCR amplification product was detected by agarose gel electrophoresis, and the electrophoresis product was recovered for subsequent use.

[0047] MVQRQRNRVSFSANLPKDVHGAFADSTICAVKYSMDPLSDIRESIREMVNNVGIQDWKEMEELIYCYI

Embodiment 2

~

1.5 or so, then centrifuge at 4000g for 5 min, collect the bacteria, and then use MMA (1 mL (1 M) MgCl

2

; 1 mL

(1 M, pH 5.6) MES; 75 μL (200 mM) As), resuspend, adjust OD

600

= about 1.0;

[0056] After the final room temperature was placed for about 3 h, it was used as a bacterial solution for transfection.

(3) instantaneous conversion

With 3

[0059] The tobacco phenotype changes after injection for 3 weeks are shown in Figure 1. It can be seen that Agrobacterium infection with TRV2-PDS

The leaves of N. benthamiana at 4 w seedling age were used as the experimental material. Using a 1 mL syringe, the

The bacterial solution for transfection was prepared and injected into tobacco leaves, and the injected tobacco was continued to be cultivated in an artificial incubator to observe the phenotypic changes.

change.

[0063].

The new leaves of the plant had bleaching phenomenon, indicating that the infection was successful; while there was no significant chan...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to the technical field of tobacco genetic engineering, and specifically relates to a tobacco transcription repressor protein OFP1 and a patent application for its application. Tobacco transcription repressor protein OFP1 consists of 87 amino acid residues, of which the 34‑83 amino acid conserved domain. This protein is related to the content of pigment substances in plant leaves. After reducing the expression of this protein, the content of pigment substances in leaves is significantly reduced. The pigment substances are: neoxanthin, violaxanthin, lutein, chlorophyll a / b ,β-carotene. Through preliminary research on the tobacco transcription repressor protein OFP1 gene, the present invention finds that it is highly correlated with the content of pigment substances in tobacco, and after it is silenced, the content of pigment substances in tobacco is significantly reduced. Utilizing this characteristic can provide new reference and reference for the cultivation of new varieties of tobacco plants.

Description

Tobacco transcriptional repressor OFP1 and its application technical field The invention belongs to the technical field of tobacco genetic engineering, be specifically related to tobacco transcriptional repressor protein OFP1 and application thereof. benefit application. Background technique [0002] Nicotiana, which people usually smoke, belongs to the Dicotyledonous plant class Anchiaceae Solanaceae Nicotiana, Nicotiana There are more than 60 species of Nicotiana (Nicotiana), and the tobacco used in the preparation of smoking is mainly two cultivars, of which the common tobacco (Nicotiana) Nicotiana tabacum, also known as Nicotiana tabacum, occupies the majority of the area, while Nicotiana rustica's The cultivation area is relatively small. Cultivated tobacco can be divided into flue-cured tobacco, sun-cured tobacco, There are six types of air-cured tobacco, burley tobacco, oriental tobacco and yellow-flowered tobacco, among which flue-cured tobacco is the most ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Patents(China)
IPC IPC(8): C12N15/29C07K14/415C12N15/82C12N15/11A01H5/00A01H6/82
CPCC07K14/415C12N15/825
Inventor 卢鹏陈千思许亚龙李泽锋刘萍萍郑庆霞金静静曹培健周会娜
Owner ZHENGZHOU TOBACCO RES INST OF CNTC
Features
  • Generate Ideas
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More